GABRG2-R86

(0)No Reviews yet
$50.00
SKU: GABRG2-R86-p

In Stock

Available: 13

DSHB Data Sheet

Catalog Fields

Clone ID/Product Name: GABRG2-R86
Available to For-Profits: Yes
Alternate Antibody Name:
Gene Symbol: Gabrg2
Ab Isotype: Rabbit IgG
Gene Name:
Antibody Registry ID: AB_2877081 
Uniprot ID: P18508 
RRID:  
Entrez Gene ID: 29709 
Clonality: Polyclonal
Immunogen: Synthetic peptide
Clone:
Immunogen Sequence: QKSDDDYEDYASNKTWVLTPKVPEGDVTVC (Q= pyroglutamate)
Myeloma Strain:
Epitope Mapped: Yes
Antigen Name: Gamma-aminobutyric acid receptor subunit gamma-2
Epitope Location or Sequence: N-terminus amino acids 1-15
Alternate Antigen Name:
Deposit Date: 6/2/2019
Antigen Molecular Weight: 54.0 kDa
Depositor: De Blas, Angel L.
Antigen Sequence:
Depositor Institution: University of Connecticut
Antigen Species: Rat
Depositor Notes: The synthetic peptide immunogen was coupled to a carrier protein by a C-end, which was added if not present in the peptide. IP, IB (1:500)
Host Species: rabbit
Hybridoma Cells Available (Non-Profit): No
Confirmed Species Reactivity: Rat
Additional Information: Affinity-purified antibody also validated for IHC and IF.
Predicted Species Reactivity:  
Human Protein Atlas:  
Additional Characterization:  
Recommended Applications: Immunoprecipitation, Western Blot
All cell products contain the antimicrobial ProClin. Click here for additional information.
These hybridomas were created by your colleagues. Please acknowledge the hybridoma contributor and the Developmental Studies Hybridoma Bank (DSHB) in the Materials and Methods of your publications. Please email the citation to us.
For your Materials & Methods section:
GABRG2-R86 was deposited to the DSHB by De Blas, Angel L. (DSHB Hybridoma Product GABRG2-R86)
Storage and Handling Recommendations
Although many cell products are maintained at 4°C for years without loss of activity, shelf-life at 4°C is highly variable. For immediate use, short term storage at 4°C up to two weeks is recommended. For long term storage, divide the solution into volumes of no less than 20 ul for freezing at -20°C or -80°C. The small volume aliquot should provide sufficient reagent for short term use. Freeze-thaw cycles should be avoided. For concentrate or bioreactor products, an equal volume of glycerol, a cryoprotectant, may be added prior to freezing.
Usage Recommendations
The optimal Ig concentration for an application varies by species and antibody affinity. For each product, the antibody titer must be optimized for every application by the end user laboratory. A good starting concentration for immunohistochemistry (IHC), immunofluorescence (IF), and immunocytochemistry (ICC) when using mouse Ig is 2-5 ug/ml. For western blots, the recommended concentration range of mouse Ig 0.2-0.5 ug/ml. In general, rabbit antibodies demonstrate greater affinity and are used at a magnitude lower Ig concentration for initial testing. The recommended concentrations for rabbit Ig are 0.2-0.5 ug/ml (IF, IHC and ICC) and 20-50 ng/ml (WB).

1 Reference

  • Initial Publication
  • WB References
  • Epitope Map References
  • All References
  • Ratings & Reviews

    No reviews available

    Be the first to Write a Review